Cell Signaling Kinase Enzyme Systems-continued Product Cat.# p38a Kinase Enzyme System ADP-Glo™ Kinase Assay + p38a Kinase Enzyme System p38g Kinase Enzyme System ADP-Glo™ Kinase Assay + p38g Kinase Enzyme System p70S6K Kinase Enzyme System ADP-Glo™ Kinase Assay + p70S6K Kinase Enzyme System PAK4 Kinase Enzyme System ADP-Glo™ Kinase Assay + PAK4 Kinase Enzyme System PDGFRα Kinase Enzyme System ADP-Glo™ Kinase Assay + PDGFRα Kinase Enzyme System PDGFRβ Kinase Enzyme System ADP-Glo™ Kinase Assay + PDGFRβ Kinase Enzyme System PDK1 Kinase Enzyme System ADP-Glo™ Kinase Assay + PDK1 Kinase Enzyme System PKCα Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCα Kinase Enzyme System PKCβ II Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCβ II Kinase Enzyme System PKCγ Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCγ Kinase Enzyme System PKCδ Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCδ Kinase Enzyme System PKCζ Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCζ Kinase Enzyme System PKCι Kinase Enzyme System ADP-Glo™ Kinase Assay + PKCι Kinase Enzyme System PLK1 Kinase Enzyme System ADP-Glo™ Kinase Assay + PLK1 Kinase Enzyme System RET Kinase Enzyme System ADP-Glo™ Kinase Assay + RET Kinase Enzyme System ROCK1 Kinase Enzyme System ADP-Glo™ Kinase Assay + ROCK1 Kinase Enzyme System Size V2701 10µg V9591 1 each V3371 10µg V9601 1 each V2741 10µg V9611 1 each V3201 10µg V9451 1 each V3721 10µg V8011 1 each V3731 10µg V8021 1 each V2761 10µg V9681 1 each V3381 10µg V9691 1 each V3741 10µg V9701 1 each V3391 10µg V9711 1 each V3401 10µg V9721 1 each V2781 10µg V9731 1 each V3751 10µg V9751 1 each V2841 10µg V8041 1 each V3761 10µg V8061 1 each V3411 10µg V9581 1 each Kinase p38a, 10µg (Human, recombinant full-length) p38g, 10µg (Human, recombinant full-length) p70S6K, 10µg (Human, recombinant full-length) PAK4, 10µg (Human, recombinant full-length) PDGFRα, 10µg (Human, recombinant; amino acids 550-end) PDGFRβ, 10µg (Human, recombinant; amino acids 557-end) PDK1, 10µg (Human, recombinant full-length) PKCα, 10µg (Human, recombinant full-length) PKCβ II, 10µg (Human, recombinant full-length) PKCγ, 10µg (Human, recombinant full-length) PKCδ, 10µg (Human, recombinant full-length) PKCζ, 10µg (Human, recombinant full-length) PKCι, 10µg (Human, recombinant full-length) PLK1, 10µg (Human, recombinant full-length) RET, 10µg (Human, recombinant; amino acids 658-end) ROCK1, 10µg (Human, recombinant; amino acids 17-535) Molecular Weight ~67kDa ~71kDa ~76 kDa p38 peptide p38 peptide S6K substrate (KRRRLASLR); derived from human 40S ribosomal protein S6 (amino acid 230-238). ~90kDa Modifi ed AKT Substrate II peptide (modifi ed-CKRPRAASFAE); based on the N-terminus of GSK3. ~95 kDa ~104kDa Poly (4:1 Glu, Tyr) Peptide Poly (4:1 Glu, Tyr) Peptide ~67 kDa PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC); derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984). ~103 kDa ~105 kDa ~105 kDa ~104 kDa ~93 kDa ~98 kDa CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). PKCtide (ERMRPRKRQGSVRRRV); derived from protein kinase C epsilon (amino acid 149-164). CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). CREBtide (KRREILSRRPSYR); derived from human CREB1 isoform A (amino acid 109-121). ~70kDa Casein, Dephosphorylated (Bovine) ~74 kDa ~85 kDa IGF1Rtide (KKKSPGEYVNIEFG); derived from human IRS-1 protein residues 891-902. S6K substrate (KRRRLASLR); derived from human 40S ribosomal protein S6 (amino acid 230-238). Substrate Other Reaction Buffer; DTT Reaction Buffer; DTT 3 Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT; Lipid solution Reaction Buffer; DTT; Lipid solution Reaction Buffer; DTT; Lipid solution Reaction Buffer; DTT Reaction Buffer; DTT; Lipid solution Reaction Buffer; DTT Reaction Buffer; DTT Reaction Buffer; DTT; Lipid solution 9526LD For complete and up-to-date product information visit: www.promega.com/catalog 59 Cell Signaling Pagina 62
Pagina 64Heeft u een onderwijscatalogus, digibrochure of e-onderwijs catalogi? Gebruik Online Touch: relatiemagazine digitaal bladerbaar publiceren.
Promega Switzerland - Life Sciences Catalog 2012 Lees publicatie 100Home